Эксперт по ферментам отвергает теорию эволюции

Интервью с финским биохимиком Матти Лейсола

Джонатан Сарфати
Перевод: Алексей Калько (creationist.in.ua)
Переведено с разрешения creation.com

Присоединяйтесь к нам на Facebook!

Нажмите «Нравится», чтобы первыми узнавать о новых статьях

Матти Лейсола

Матти Лейсола получил степень доктора наук в области биотехнологии в Технологическом университете Хельсинки (Финляндия) в 1979 году. За свою успешную карьеру он, в числе прочего, выиграл премию Латсиса как выдающийся молодой исследователь в 1987 году в Швейцарии, был директором по исследованиям (1988–1997) в международной биотехнологической компании, а также деканом факультета химии и материаловедения в новом финском Университете Аалто. Он опубликовал более 140 статей, большей частью на тему исследований ферментов, является автором 20 глав в книгах и материалах конференций и получил семь патентов. Научные статьи доктора Лейсола более 5000 раз цитируются в научной литературе. Матти является действующим вице-президентом Международного общества исследований редких углеводов и главным редактором открытого журнала «BIO-Complexity».


Многие из наших читателей помнят доктора Матти Лейсола по документальному фильму о Дарвине, «Путешествие, которое потрясло мир», снятому миссией Creation Ministries International в 2009 году. Но в научном сообществе он гораздо более известен как эксперт в области ферментов. Доктор Лейсола объясняет:

«Мне нравится называть ферменты "инструментами жизни". Ферменты – это разновидность белков – макромолекул (больших молекул), состоящих из определённым образом выстроенной цепочки аминокислот. Они являются катализаторами жизни, то есть они значительно ускоряют специфические химические реакции в живых клетках. Ферменты идентифицируют, преобразовывают, передают, переносят, окисляют, восстанавливают, соединяют молекулы вместе и разрывают их на части».

Инструкции по их созданию кодируются в нашей ДНК. Доктор Лейсола объясняет, что как в финском языке 29 букв,1 так язык ферментов имеет 20 биохимических «букв» (аминокислот), каждая из которых кодируется трёхбуквенными «словами» на языке ДНК (который имеет четыре разные буквы). Например, строка «Матти Лейсола» является конкретной комбинацией из 12 букв и одного пробела. «Эта комбинация настолько специфична, что это помогает найти меня из всех людей в мире, так как, насколько я знаю, нет никого больше с такой же комбинацией. В среднем фермент состоит из около 300 биохимических букв. Благодаря этому каждый фермент является очень специализированным для выполнения своей задачи».

Ксиланаза

Модель фермента ксиланаза – сложного механизма, состоящего из точной последовательности аминокислот

Например, группа Матти изучала фермент ксиланаза (см. рисунок справа). Этот фермент расщепляет один из самых распространённых углеводородных полимеров на земле – ксилан, содержащийся в клеточных стенках растений. Это волокно составляет около 30% массы берёзового дерева. Фермент ксиланаза состоит из около 200 аминокислот. Его белковый код – предложение, которое говорит: «расщепи ксилан». У млекопитающих этот фермент отсутствует, поэтому они не могут переваривать ксилан.

Используя различные буквы для различных аминокислот, белковое «предложение» может быть записано в следующем виде:

ASINYDQNYQTGGQVSYSPSNTGFSVNWNTQDDFVVGVGWTGSS
APINFGGSFSVNSGTGLLSVYGWSTNPLVEYYIMEDNHNYPAQGTVK
GTVTSDGATYTIWENTRVNEPSIQGTATFNQYISVRNSPRTSGTVTVQ
NHFNAWASLGLHLGQMNYQVVAVEGWGGSGSASQSVSN

Именно такая последовательность фермента позволяет этому молекулярному механизму выполнять свою задачу. Никакие химические или физические свойства аминокислот, из которых состоит ксиланаза, не могут заставить их выстроиться в нужном порядке. Порядок – т.е. информация – наложен на материю посредством последовательности, в которой выстроены аминокислоты, в соответствии с запрограммированными инструкциями внутри клетки.

Отвергая эволюцию

Мы взяли интервью у доктора Лейсола, потому что он – известный скептик эволюции «от молекул к человеку», которую он называет «сочинением историй». Но он не всегда был настроен скептически, как он сам рассказывает:

«Я верил в общепринятую историю примерно до 22 лет. Я использовал её (как я тогда считал) как мощное оружие в дискуссиях против христианского Бога. Не осознавая этого, я был типичным продуктом западной натуралистической системы образования, и я однозначно хотел оставаться самостоятельным, и ненавидел саму мысль, что Бог может вмешиваться в мою жизнь».

Но Матти изменил свою точку зрения, благодаря своей девушке (а сегодня жене) Марии:

«Она стала христианкой, и я вдруг столкнулся с реальностью её изменившейся жизни и новых ценностей. Это привело меня к исследованию доказательств в пользу христианства. Эти поиски привели меня ко Христу. Затем я захотел понять, насколько дарвинизм силён против христианства. Не потребовалось больших усилий, чтобы понять, что он стоит на зыбкой почве. Впервые я понял это при изучении биохимии и слабых попыток объяснить происхождение жизни, основываясь на некоторых элементарных экспериментах. Так что всё началось с изменений в моей системе убеждений. Каждый человек имеет систему убеждений, и использует её при интерпретировании фактов; но дело вовсе не в фактах».
Матти Лейсола с женой Марией

Доктор Матти Лейсола и его жена Мария. У них четверо детей и пять внуков.

Его собственная область – исследование ферментов – решительно говорит против эволюции и в пользу Создателя. Он утверждает, что, вопреки распространённому мнению, не существует никакого разумного натуралистического объяснения происхождения таких информационно богатых и функциональных молекул, или изменения одного их типа в другой: «Очень трудно получить последовательность букв "Матти Лейсола" путём случайного процесса. Гораздо труднее получить биохимическое предложение, которое определяет фермент ксиланазу». Но, более того, даже простейшим живым организмам необходимо более 350 функционирующих ферментов,2 равных по сложности ксиланазе. Естественный отбор не может помочь теориям происхождения жизни объяснить, как возникли ферменты, необходимые для жизни, потому что для естественного отбора требуются уже самовоспроизводящиеся организмы, а значит, он не может быть использован для объяснения их происхождения.3

Матти также отмечает «тысячи взаимосвязанных и тщательно регулируемых функций в живом мире. Это верно на многих уровнях: на уровне отдельной клетки, многоклеточного организма, симбиотических отношений, коллективного разума, например, у муравьёв и пчёл, а также сбалансированной экосистемы. И все эти замечательные вещи кодируются только четырьмя буквами ДНК. Дизайн начинается с мыслительного процесса, и Разум, который смог одновременно планировать и обеспечивать работу этой огромной, сложной, чрезвычайно целостной системы, от мельчайших деталей до её совокупности в целом, находится полностью за пределами нашего ограниченного понимания. Мы должны смиренно преклониться перед таким величием и признать, что мы – действительно ничто. Псалом 91:6, описывая сотворение, говорит о Боге: "дивно глубоки помышления Твои!", и далее в 7-м стихе псалом продолжает: "невежда не разумеет того"».

Настоящая наука против эволюции

Когда Матти начал сомневаться в эволюции, он только начинал свою научную карьеру. Он спрашивал своих профессоров, как эволюция может создавать биологические новшества:

У них, конечно, были в запасе истории, но, когда дело доходило до механизмов эволюции (в чём, по сути, и заключается наука), у них не было никаких реальных объяснений.
«У них, конечно, были в запасе истории, но, когда дело доходило до механизмов эволюции (в чём, по сути, и заключается наука), у них не было никаких реальных объяснений. Позже на различных научных конференциях, посвящённых ферментам, я начал представлять подтверждения тому, что у случайных изменений есть пределы, и их до сих пор никто не оспорил».

Опубликовав более ста широко цитируемых научных статей, доктор Лейсола, должно быть, смеётся над часто слышимой фразой, будто «ни один настоящий учёный не отрицает эволюцию». Но они переопределяют науку как натурализм, и Матти уточняет: «настоящий учёный ищет правду о природе, а не натуралистические объяснения».

Но разве вера в сотворение не наносит вред науке? Напротив, доктор Лейсола утверждает:

«Христианство является основой современной науки и объясняет, почему мы вообще можем заниматься наукой: разумный Бог создал разумного человека по Своему образу, так что он может постигать творение своим умом. Действительно, Творец Иисус Христос назван Словом (Λόγος, Иоанна 1:1–3), и это объясняет упорядоченную вселенную и сложность жизни. Те, кто верят в натуралистические объяснения возникновения жизни, имеют слепую веру».

Эволюция от бактерии до биолога не имеет никакого отношения к реальной научной работе, но многие утверждают, что имитация эволюции, т.е. случайные изменения и искусственный отбор, привели к образованию новых ферментов.4 Однако доктор Лейсола, как эксперт в этой области,5 утверждает:

«Эти методы, даже под тщательным контролем, не создают ничего, кроме незначительных адаптаций или вариаций. Моя исследовательская группа, например, разработала ферменты, которые лучше функционируют в экстремальных условиях, а также микроорганизмы, которые производят новые молекулы. Но в основе этих достижений был уже существующий, хорошо разработанный фермент, эксперименты были интеллектуально контролируемы, кроме того, всегда есть предел изменениям. Неудивительно, что живые клетки сопротивляются случайным изменениям, потому что они почти всегда ведут вниз».

Почему сотворение имеет значение?

Матти Лейсола перевёл ряд креационистских книг на финский язык, а также субтитры к нашему фильму о Дарвине; также он организовал приезд в Финляндию многих зарубежных учёных-креационистов, в том числе доктора А.Е. Уайлдер-Смита (1915–1995). Почему же это так важно?

Доктор Лейсола отвечает:

Cотворение является фундаментом для понимания нашего места и роли во Вселенной
«Один из главных вопросов, стоящих перед людьми – "Откуда мы произошли?" Апостол Павел пишет в послании к Римлянам 1, что невидимые качества Бога так ясно видны в Его творении, что у тех, кто отрицает Его существование, нет ни единого оправдания. Поэтому сотворение является фундаментом для понимания нашего места и роли во Вселенной».

Оно также очень важно для понимания того, что такое правильно и неправильно. Доктор Лейсола занимает активную позицию по вопросу этической стороны биотехнологии.6 Он согласен с эволюционным философом, агностиком Майклом Рузом, который сказал, что если эволюция – правда, то этика – всего лишь иллюзия:

«Без абсолютов не может быть никаких этических стандартов. Это ясно видно в развитии нашей западной культуры. Когда христианский консенсус исчез, общество безрезультатно пытается навязать людям правила. Всё больше и больше людей поступают так, как хотят, и всё меньше и меньше людей задаются вопросом, что правильно, а что неправильно».

Но, в отличие от Руза, Матти вторит словам апостола Павла: «Я не стыжусь Евангелия – оно даёт ответы на важные вопросы, на которые никакое другое мировоззрение ответов не даст: Откуда возникла вселенная и жизнь, на чём основана уникальность человека и мораль, и что даёт прочное основание для равенства всех людей и ценности личности. Современный человек растерян, потому что не имеет рациональных ответов на эти вопросы».

Наконец, я спросил доктора Лейсола, что бы он посоветовал молодому христианину, который хочет заниматься наукой:

«Лучшие советы находятся в Библии. Будьте всегда готовы дать ответ, на чём основана ваша вера (1 Петра 3:15). Не стыдитесь Евангелия, потому что в нём ответы, которые люди ищут (Римлянам 1:16) и будьте мудры, как змеи, и просты, как голуби (Матфея 10:16). Не переживайте, когда мир вас ненавидит – это хороший сигнал, если конечно, мир ненавидит вас за Иисуса (Иоанна 15:18-20)».

Статьи по теме

Видео по теме

Ссылки и примечания

  1. Финский алфавит похож на английский, но он также содержит отдельные буквы Å, Ä, Ö. Каждая буква произносится, поэтому двойная т в «Матти» произносится как в слове «оТТенок», а двойная к в таких именах как «Эркки» и «Пекка» произносится как в слове «броККолли». Сам язык является не индо-европейским, а финно-угорским, поэтому сильно отличается от большинства других европейских языков, и, вероятно, произошёл от другого вавилонского ответвления. Назад к тексту
  2. Исследование под руководством Гамильтона Смита в Институте Дж. Крейга Вентера в Роквилле показало, что минимальный геном состоит из 387 генов, кодирующих белок и 43 генов, кодирующих РНК (Nature439, 246–247 (19 января 2006 г.) | doi:10.1038/439246a; Natl Acad. Sci. USA 103:425–430, 2006 г.). Назад к тексту
  3. Например, исследователь Ричард Вулфенден сказал так об этом слепом пятне: «Без катализаторов не было бы никакой жизни вообще, от микробов до человека. Это заставляет задуматься, каким образом действовал естественный отбор, что произвёл белок, который начал действовать в качестве примитивного катализатора для такой чрезвычайно медленной реакции». Цитируется в Lang, L.H., Without enzyme catalyst, slowest known biological reaction takes 1 trillion years, UNC School of Medicine, unc.edu, 5 мая 2003 г. См. такжеNatural selection cannot explain the origin of life (Естественный отбор не может объяснить происхождение жизни). Назад к тексту
  4. О похожем утверждении см. Batten, D., Genetic algorithms and robotic folly, Creation14(3):13–15, 2000 г. Назад к тексту
  5. Leisola, M. and Turunen, O., Protein engineering: opportunities and challenges, Microbiol. Biotechnol. 75(6):225–232, 2007 | DOI 10.1007/s00253-007-0964-2. Назад к тексту
  6. Leisola, Bioscience, Bioinnovations, and Bioethics. Adv Biochem Eng / Biotech 107: 41–56, 2007 http://dx.doi.org/10.1007/ 10_2007_052. Ojala, P.J., Vähäkangas, J.M., Лейсола M., Evolutionism in the Haeckelian shadow—Harry Federley, the father of the Finnish genetics and eugenics legislation, as a recapitulationist and a Monist propagator, Yearbook for European Culture of Science 1:61–86, Stuttgart, Germany, 2005. Ojala, P.J. и Лейсола M., Haeckel: legacy of fraud to popularise evolution, J. Creation 21(3):102–110, 2007 г. Назад к тексту

ПРИСОЕДИНЯЙТЕСЬ!

Наверх